Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEKRAAAGLEGAPGARAQLAVVCLVNIFLTGRLSSAVPALAACSGKLEQH TERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCS LDWLLLGPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQ GFRLSYIRGKLGQASCQADEFRCDNGKCLPGPWQCNTVDECGDGSDEGNC SAPASEPPGSLCPGGTFPCSGARSTRCLPVERRCDGLQDCGDGSDEAGCP DLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDSRRVLLQLEL RLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHAR ARSAGHGFNATYQVKGYCLPWEQPCGSSSDSDGGSLGDQGCFSEPQRCDG WWHCASGRDEQGCPACPPDQYPCEGGSGLCYTPADRCNNQKSCPDGADEK NCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITA ALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEFVRREAP PSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPS RRRLGRLWNRLFHRPRAPRGQIPLLTAARPSQTVLGDGFLQPAPGAAPDP PAPLMDTGSTRAAGDRPPSAPGRAPEVGPSGPPLPSGLRDPECRPVDKDR KVCREPLADGPAPADAPREPCSAQDPHPQVSTASSTLGPHSPEPLGVCRN PPPPCSPMLEASDDEALLVC
    • Amino acids
      1 to 770
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 105 kDa low-density lipoprotein receptor-related protein
    • CTD-2540B15.13
    • hLRp105
    • Low density lipoprotein receptor related protein 3
    • Low-density lipoprotein receptor-related protein 3
    • LRP-3
    • Lrp3
    • LRP3_HUMAN
    see all
  • Function
    Probable receptor, which may be involved in the internalization of lipophilic molecules and/or signal transduction. Its precise role is however unclear, since it does not bind to very low density lipoprotein (VLDL) or to LRPAP1 in vitro.
  • Tissue specificity
    Widely expressed. Highly expressed in skeletal muscle and ovary. Expressed at intermediate level in heart, brain, liver, pancreas, prostate and small intestine. Weakly expressed in testis, colon and leukocyte.
  • Sequence similarities
    Belongs to the LDLR family.
    Contains 2 CUB domains.
    Contains 4 LDL-receptor class A domains.
  • Cellular localization
    Membrane. Membrane > coated pit.
  • Information by UniProt

Images

  • ab158829 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up