Description

  • Product name

    Recombinant Human LRPAP1 protein (Mutant)
    See all LRPAP1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAPRRVRSFLRGLPALLLLLLFLGPWPAASHGGKYSREKNQPKPSPKRES GEEFRMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDG LDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPR LEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLSRTEEIH ENVISPSDLSDIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEA EFEEPRVIDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEI AHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRIS RARHNEL
    • Predicted molecular weight

      41 kDa
    • Amino acids

      1 to 357

Specifications

Our Abpromise guarantee covers the use of ab233667 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    This stable mutant form of human LRPAP1 is resistant to both pH and heat induced denaturation. ab233667 does not unfold at pH 5.5 and has a melting temperature of 73°C, more than 30 degrees above that of wild type RAP. It is also more resistant to trypsin and chymotrypsin mediated proteolysis. LRPAP1 mutant may be useful in multiple pathological settings where LRP1 blockade has shown to be effective.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.50
    Constituents: 0.48% HEPES, 0.87% Sodium chloride, 0.01% Calcium chloride

General Info

  • Alternative names

    • 39 kDa receptor-associated protein
    • A2MRAP
    • A2RAP
    • Alpha 2 macroglobulin receptor associated protein
    • Alpha 2 MRAP
    • Alpha-2-macroglobulin receptor-associated protein
    • Alpha-2-MRAP
    • AMRP_HUMAN
    • HBP44
    • Lipoprotein receptor associated protein
    • Low density lipoprotein receptor related protein associated protein 1
    • Low density lipoprotein receptor-related protein-associated protein 1
    • Low density lipoprotein related protein associated protein 1
    • Low density lipoprotein related protein associated protein 1 alpha 2 macroglobulin receptor associated protein
    • low density lipoprotein-related protein-associated protein 1 (alpha-2-macroglobulin receptor-associated protein 1)
    • Lrpap1
    • MGC138272
    • MRAP
    • MYP23
    • RAP
    see all
  • Function

    Interacts with LRP1/alpha-2-macroglobulin receptor and glycoprotein 330.
  • Involvement in disease

    Note=In complex with the alpha-2-MR or gp330, it may have some role in the pathogenesis of membrane glomerular nephritis.
  • Sequence similarities

    Belongs to the alpha-2-MRAP family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Endoplasmic reticulum. Cytoplasm. Cell surface. Intracellular and associated with cell surface receptors. Found in the endoplasmic reticulum.
  • Information by UniProt

References

ab233667 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233667.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up