Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKLHCEVEVISRHLPALGLRNRGKGVRAVLSLCQQTSRSQPPVRAFLLIS TLKDKRGTRYELRENIEQFFTKFVDEGKATVRLKEPPVDICLSKDSIWLS
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165191 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as PPIL5.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4 1BB mediated signaling molecule
    • 4 1BBlrr
    • 4-1BB-mediated-signaling molecule
    • 4-1BBlrr
    • Cyclophilin like 5
    • Leucine-rich repeat protein 1
    • LLR1_HUMAN
    • LRR 1
    • LRR repeat protein 1
    • LRR-1
    • LRR-repeat protein 1
    • LRR1
    • MGC20689
    • peptidylprolyl isomerase (cyclophilin) like 5
    • Peptidylprolyl isomerase like 5
    • Peptidylprolyl isomerase-like 5
    • PPIL5
    see all
  • Function
    May negatively regulate the 4-1BB-mediated signaling cascades which result in the activation of NK-kappaB and JNK1. Probable substrate recognition subunit of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Tissue specificity
    Ubiquitous. Maximal expression was seen in the heart and skeletal muscle and minimal expression seen in the kidney.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 7 LRR (leucine-rich) repeats.
  • Information by UniProt

Images

  • ab165191 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165191 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165191.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up