Overview

  • Product name

    Recombinant Human LRRC25/MAPA protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSG NGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCAL ESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCAPGLASATVDHHH HHH
    • Molecular weight

      17 kDa including tags
    • Amino acids

      21 to 165
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab194037 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 0.100 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab194037 was determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as LRRC25

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C.

    pH: 7.4
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution.

General Info

  • Alternative names

    • FLJ38116
    • Leucine rich repeat containing 25
    • Leucine rich repeat containing protein 25
    • LRRC 25
    • MAPA
    • Monocyte and plasmacytoid activated molecule
    see all
  • Relevance

    LRRC25 is a single-pass type I membrane protein. It contains 2 LRR (leucine-rich) repeats. LRRC25 may be involved in the activation of cells of innate and acquired immunity.
  • Cellular localization

    Membrane; Single-pass type I membrane protein.

References

ab194037 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194037.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up