Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      AVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAI EHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI
    • Amino acids

      541 to 640
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153462 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Netrin G1 ligand

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 6430556C10Rik
    • KIAA1580
    • Leucine rich repeat containing 4C
    • Leucine-rich repeat-containing protein 4C
    • LRC4C_HUMAN
    • LRRC4C
    • mKIAA1580
    • Netrin-G1 ligand
    • NGL 1
    • NGL-1
    • NGL1
    • RGD1311013
    see all
  • Function

    May promote neurite outgrowth of developing thalamic neurons.
  • Tissue specificity

    Highly expressed in the cerebral cortex, including frontal, parietal and occipital lobes. Putamen, amygdala, hippocampus and medulla oblongata show moderate expression. Caudate nucleus and thalamus express small amounts, whereas other brain regions show very weak or no expression.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 9 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 LRRNT domain.
  • Domain

    The LRR region is both necessary and sufficient for the interaction with NTNG1.
  • Cellular localization

    Cell junction, synapse, postsynaptic cell membrane.
  • Information by UniProt

Images

  • ab153462 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153462 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153462.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up