Overview

  • Product name
    Recombinant Human LRRC6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGWITEDLIRRNAEHNDCVIFSLEELSLHQQEIERLEHIDKWCRDLKILY LQNNLIGKIENVSKLKKLEYLNLALNNIEKIENLEGCEELAKLDLTVNFI GELSSIKNLQHNIHLKELFLMGNPCASFDHYREFVVATLPQLKWLDGKEI EPSERIKALQDYSVIEPQIREQEKDHCLKRAKLKEEAQRKHQEEDKNEDK RSNAGFDGRWYTDINATLSSLESKDHLQAPDTEEHNTKKLDNSEDDLEFW NKPCLFTPESRLETLRHMEKQRKKQEKLSEKKKKVKPPRTLITEDGKALN VNEPKIDFSLKDNEKQIILDLAVYRYMDTSLIDVDVQPTYVRVMIKGKPF QLVLPAEVKPDSSSAKRSQTTGHLVICMPKVGEVITGGQRAFKSMKTTSD RSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPEPKIIPS EEDPTFEDNPEVPPLI
    • Amino acids
      1 to 466
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Leucine rich repeat containing 6
    • Leucine rich repeat containing protein 6
    • Leucine rich testis specific protein
    • Leucine-rich repeat-containing protein 6
    • Leucine-rich testis-specific protein
    • Lrrc6
    • LRTP
    • Protein TILB homolog
    • Testis specific leucine rich repeat protein
    • Testis-specific leucine-rich repeat protein
    • TILB_HUMAN
    • TSLRP
    see all
  • Function
    May play a role in dynein arm assembly, hence essential for proper axoneme building for cilia motility.
  • Tissue specificity
    Expressed predominantly in testis and in nasal epithelial cells.
  • Involvement in disease
    Defects in LRRC6 are the cause of primary ciliary dyskinesia 19 (CILD19) [MIM:614935]. A disorder characterized by abnormalities of motile cilia. Respiratory infections leading to chronic inflammation and bronchiectasis are recurrent, due to defects in the respiratory cilia; reduced fertility is often observed in male patients due to abnormalities of sperm tails. Half of the patients exhibit randomization of left-right body asymmetry and situs inversus, due to dysfunction of monocilia at the embryonic node. Primary ciliary dyskinesia associated with situs inversus is referred to as Kartagener syndrome.
  • Sequence similarities
    Belongs to the tilb protein family.
    Contains 1 CS domain.
    Contains 4 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
  • Cellular localization
    Cytoplasm. Cell projection > cilium.
  • Information by UniProt

Images

  • ab161732 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161732 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161732.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up