Overview

  • Product name
    Recombinant Human LRRC67 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVRLTLDLIARNSNLKPRKEETISQCLKKITHINFSDKNIDAIEDLSLCK NLSVLYLYDNCISQITNLNYATNLTHLYLQNNCISCIENLRSLKKLEKLY LGGNYIAVIEGLEGLGELRELHVENQRLPLGEKLLFDPRTLHSLAKSLCI LNISNNNIDDITDLELLENLNQLIAVDNQLLHVKDLEFLLNKLMKLWKID LNGNPVCLKPKYRDRLILVSKSLGTYLY
    • Amino acids
      1 to 228
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166222 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DTR
    • Leucine-rich repeat-containing protein 67
    • LRC67_HUMAN
    • lrrc67
    • PPP1R42
    • Protein phosphatase 1 regulatory subunit 42
    • Testis leucine-rich repeat
    • TLLR
    see all
  • Sequence similarities
    Contains 7 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
  • Information by UniProt

Images

  • ab166222 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166222 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166222.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up