Recombinant Human LRRC8A protein (ab163372)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant Human LRRC8A protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIE LRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA -
Amino acids
711 to 810 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab163372 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- AGM5
- FLJ10337
- FLJ41617
see all -
Function
Involved in B-cell development. Required for the pro-B cell to pre-B cell transition. -
Tissue specificity
Expressed in brain, kidney, ovary, lung, liver, heart, and fetal brain and liver. Found at high levels in bone marrow; lower levels are detected in peripheral blood cells. Expressed on T-cells as well as on B-lineage cells. -
Involvement in disease
Defects in LRRC8A are the cause of agammaglobulinemia type 5 (AGM5) [MIM:613506]. It is a primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B-cells due to an early block of B-cell development. Affected individuals develop severe infections in the first years of life. Note=A chromosomal aberration involving LRRC8 has been found in a patient with congenital agammaglobulinemia. Translocation t(9;20)(q33.2;q12). The translocation truncates the LRRC8 gene, resulting in deletion of the eighth, ninth, and half of the seventh LRR domains. -
Sequence similarities
Contains 17 LRR (leucine-rich) repeats. -
Cellular localization
Membrane. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human LRRC8A protein (ab163372)ab163372 on a 12.5% SDS-PAGE stained with Coomassie Blue.
Datasheets and documents
References
ab163372 has not yet been referenced specifically in any publications.
