Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGTPASGRKRTPVKDRFSAEDEALSNIAREAEARLAAKRAARAEARDIRM RELERQQKELDEKSDKQYAENYTRPSSRNSASATTPLSGNSSRRGSGDTS SLIDPDTSLSELRESLSEVEEKYKKAMVSNAQLDNEKNNLIYQVDTLKDV IEEQEEQMAEFYRENEEKSKELERQKHMCSVLQHKMEELKEGLRQRDELI EKHGLVIIPDGTPNGDVSHEPVAGAITVVSQEAAQVLESAGEGPLDVRLR KLAGEKEELLSQIRKLKLQLEEERQKCSRNDGTVGDLAGLQNGSDLQFIE MQRDANRQISEYKFKLSKAEQDITTLEQSISRLEGQVLRYKTAAENAEKV EDELKAEKRKLQRELRTALDKIEEMEMTNSHLAKRLEKMKANRTALLAQQ
    • Amino acids
      1 to 400
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160380 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5133400F20Rik
    • AI850587
    • DKFZp434H2035
    • FLJ20248
    • FLJ22683
    • FLJ58304
    • HUFI 2
    • Leucine rich repeat (in FLII) interacting protein 2
    • Leucine rich repeat flightless interacting protein 2
    • Leucine-rich repeat flightless-interacting protein 2
    • LRR FLII interacting protein 2
    • LRR FLII-interacting protein 2
    • LRRF2_HUMAN
    • Lrrfip2
    see all
  • Function
    May function as activator of the canonical Wnt signaling pathway, in association with DVL3, upstream of CTNNB1/beta-catenin.
  • Tissue specificity
    Ubiquitous with higher expression in heart and skeletal muscle.
  • Sequence similarities
    Belongs to the LRRFIP family.
  • Information by UniProt

Images

  • ab160380 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160380 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160380.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up