Description

  • Product name

    Recombinant Human LRSAM1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPLFFRKRKPSEEARKRLEYQMCLAKEAGADDILDISKCELSEIPFGAFA TCKVLQKKVLIVHTNHLTSLLPKSCSLLSLATIKVLDLHDNQLTALPDDL GQLTALQVLNVERNQLMQLPRSIGNLTQLQTLNVKDNKLKELPDTVGELR SLRTLNISGNEIQRLPQMLAHVRTLEMLSLDASAMVYPPREVCGAGTAAI LQFLCKESGLEYYPPSQYLLPILEQDGIENSRDSPDGPTDRFSREELEWQ NRFSDYEKRKEQKMLEKLEFERRLELGQREHTQLLQQSSSQKDEILQTVK EEQSRLEQGLSEHQRHLNAERQRLQEQLKQTEQNISSRIQKLLQDNQRQK KSSEILKSLENERIRMEQLMSITQEETESLRRRDVASAMQQMLTESCKNR LIQMAYESQRQNLVQQACSSMAEMDERFQQILSWQQMDQNKAISQILQES AMQKAAFEALQVKKDLMHRQIRSQIKLIETELLQLTQLELKRKSLDTESL QEMISEQRWALSSLLQQLLKEKQQREEELREILTELEAKSETRQENYWLI QYQRLLNQKPLSLKLQEEGMERQLVALLEELSAEHYLPIFAHHRLSLDLL SQMSPGDLAKVGVSEAGLQHEILRRVQELLDAARIQPELKPPMGEVVTPT APQEPPESVRPSAPPAELEVQASECVVCLEREAQMIFLNCGHVCCCQQCC QPLRTCPLCRQDIAQRLRIYHSS
    • Predicted molecular weight

      110 kDa including tags
    • Amino acids

      1 to 723

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CMT2P
    • E3 ubiquitin protein ligase LRSAM1
    • E3 ubiquitin-protein ligase LRSAM1
    • EC 6.3.2.-
    • FLJ31641
    • hTAL
    • Leucine rich repeat and sterile alpha motif containing 1
    • Leucine rich repeat and sterile alpha motif containing protein 1
    • Leucine-rich repeat and sterile alpha motif-containing protein 1
    • LRSAM1
    • LRSM1_HUMAN
    • OTTHUMP00000022174
    • OTTHUMP00000022175
    • RIFLE
    • TAL
    • Tsg101 associated ligase
    • Tsg101-associated ligase
    see all
  • Function

    E3 ubiquitin-protein ligase that mediates monoubiquitination of TSG101 at multiple sites, leading to inactivate the ability of TSG101 to sort endocytic (EGF receptors) and exocytic (HIV-1 viral proteins) cargos.
  • Tissue specificity

    Highly expressed in adult spinal cord motoneurons as well as in fetal spinal cord and muscle tissue.
  • Pathway

    Protein modification; protein ubiquitination.
  • Involvement in disease

    Charcot-Marie-Tooth disease 2P (CMT2P) [MIM:614436]: An axonal form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathies (designated CMT1 when they are dominantly inherited) and primary peripheral axonal neuropathies (CMT2). Neuropathies of the CMT2 group are characterized by signs of axonal degeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy. Nerve conduction velocities are normal or slightly reduced. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities

    Contains 6 LRR (leucine-rich) repeats.
    Contains 1 RING-type zinc finger.
    Contains 1 SAM (sterile alpha motif) domain.
  • Domain

    The coiled coil domains interact with the SB domain of TSG101.
    The PTAP motifs mediate the binding to UEV domains.
  • Cellular localization

    Cytoplasm. Displays a punctuate distribution and localizes to a submembranal ring.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132832 stained with Coomassie Blue.

References

ab132832 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up