Recombinant Human LSM14A protein (ab161889)

Overview

  • Product name
    Recombinant Human LSM14A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRP TDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGS STSSFQSMGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTET SNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQ TASAHLPAPAAVGRRSPVSTRPLPSASQKAGENQEHRRAEVHKVSRPENE QLRNDNKRQVAPGAPSAPRRGRGGHRGGRGRFGIRRDGPMKFEKDFDFES ANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEGN ADEEDPLGPNCYYDKTKSFFDNISCDDNRERRPTWAEERRLNAETFGIPL RPNRGRGGYRGRGGLGFRGGRGRGGGRGGTFTAPRGFRGGFRGGRGGREF ADFEYRKDNKVAA
    • Amino acids
      1 to 463
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161889 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AlphaSNBP
    • C19orf13
    • Chromosome 19 open reading frame 13
    • DKFZp434D1335
    • FAM61A
    • Family with sequence similarity 61 member A
    • hRAP55
    • hRAP55A
    • LS14A_HUMAN
    • LSM14 homolog A
    • LSM14 homolog A (SCD6 S cerevisiae)
    • LSM14A
    • Protein FAM61A
    • Protein LSM14 homolog A
    • Protein SCD6 homolog
    • Putative alpha synuclein binding protein
    • Putative alpha-synuclein-binding protein
    • RAP55
    • RNA associated protein 55
    • RNA-associated protein 55A
    • SCD6 homolog A (S cerevisiae)
    see all
  • Function
    Essential for formation of P-bodies, cytoplasmic structures that provide storage sites for non-translating mRNAs.
  • Sequence similarities
    Belongs to the LSM14 family.
    Contains 1 DFDF domain.
  • Domain
    The LSM14 domain and the RGG repeats are required for accumulation in P-bodies, and the region containing the FDF motif is responsible for cytoplasmic retention.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm. Cytoplasm > P-body. Targeted to stress granules (SGs) in response to cellular stress.
  • Information by UniProt

Images

  • ab161889 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161889 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161889.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up