Overview

  • Product name

    Recombinant Human LSM3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMADDVDQQQTTNTVEEPLDLIRLSLDE RIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKS TKRNIPMLFVRGDGVVLVAPPLRVG
    • Molecular weight

      14 kDa including tags
    • Amino acids

      1 to 102
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124558 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    Purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.03% DTT, 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • lsm3
    • LSM3 homolog
    • LSM3 protein
    • LSM3_HUMAN
    • MDS017
    • SMX4
    • U6 small nuclear RNA associated (S. cerevisiae)
    • U6 snRNA associated Sm like protein LSm3
    • U6 snRNA-associated Sm-like protein LSm3
    • USS2
    • YLR438C
    see all
  • Function

    Binds specifically to the 3'-terminal U-tract of U6 snRNA.
  • Sequence similarities

    Belongs to the snRNP Sm proteins family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg of LSM3 (ab124558).

References

ab124558 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab124558.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up