Description

  • Product name

    Recombinant Human LTBR protein (Fc Chimera)
    See all LTBR proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVC ATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGM FCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSS PSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM
    • Predicted molecular weight

      48 kDa including tags
    • Amino acids

      31 to 227
    • Additional sequence information

      This protein carries a human IgG1 Fc tag (Pro 100 - Lys 330; P01857) at the C-terminus (NP_002333). Extracellular domain.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab221224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: Tris, Glycine, L-Arginine, Sodium chloride

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD18
    • D12S370
    • LT beta R
    • LTBETAR
    • Ltbr
    • Lymphotoxin B receptor
    • Lymphotoxin beta receptor
    • Lymphotoxin beta receptor (TNFR superfamily, member 3)
    • Lymphotoxin-beta receptor
    • TNF R III
    • TNF-RIII
    • TNFCR
    • TNFR RP
    • TNFR superfamily member 3
    • TNFR-III
    • TNFR2 RP
    • TNFR2RP
    • TNFR3
    • TNFRII
    • TNFRRP
    • TNFRSF 3
    • TNFRSF3
    • TNR3_HUMAN
    • Tumor necrosis factor C receptor
    • Tumor necrosis factor receptor 2 related protein
    • Tumor necrosis factor receptor 2-related protein
    • Tumor necrosis factor receptor superfamily member 3
    • Tumor necrosis factor receptor superfamily member 3 precursor
    • Tumor necrosis factor receptor type III
    see all
  • Function

    Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab221224 stained overnight with Coomassie Blue.

    The protein migrates as 55-60 kDa under reducing conditions due to glycosylation.

  • Immobilized Human LTBR, Fc Tag (ab221224) at 5 μg/mL (100 μL/well) can bind Human LIGHT, Mouse IgG2a Fc Tag, low endotoxin, with a linear range of 0.3-5 ng/mL.

References

ab221224 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221224.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up