Description

  • Product name

    Recombinant human LTBR protein (Fc Chimera Active)
    See all LTBR proteins and peptides
  • Biological activity

    Shows the biological function of the LTBR moiety and exerts a prolonged circulating half-life caused by the modified Fc domain.

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 0.060 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVC ATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGM FCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSS PSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTM
    • Predicted molecular weight

      22 kDa
    • Amino acids

      31 to 225
    • Additional sequence information

      Fused to the N-terminus of the Fc region of a mutant human IgG1 (NP_002333.1).

Specifications

Our Abpromise guarantee covers the use of ab215015 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Non-lytic: Acts as a long lasting fusion protein which only binds to the receptor. Mutations to the complement (C1q) and FcgR I binding sites of the IgGs Fc fragment render the fusion proteins incapable of antibody directed cytotoxicity (ADCC) and complement directed cytotoxicity (CDC).

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 100% PBS

    Lyophilised from 0.2µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute at 100 µg/mL in sterile PBS.

General Info

  • Alternative names

    • CD18
    • D12S370
    • LT beta R
    • LTBETAR
    • Ltbr
    • Lymphotoxin B receptor
    • Lymphotoxin beta receptor
    • Lymphotoxin beta receptor (TNFR superfamily, member 3)
    • Lymphotoxin-beta receptor
    • TNF R III
    • TNF-RIII
    • TNFCR
    • TNFR RP
    • TNFR superfamily member 3
    • TNFR-III
    • TNFR2 RP
    • TNFR2RP
    • TNFR3
    • TNFRII
    • TNFRRP
    • TNFRSF 3
    • TNFRSF3
    • TNR3_HUMAN
    • Tumor necrosis factor C receptor
    • Tumor necrosis factor receptor 2 related protein
    • Tumor necrosis factor receptor 2-related protein
    • Tumor necrosis factor receptor superfamily member 3
    • Tumor necrosis factor receptor superfamily member 3 precursor
    • Tumor necrosis factor receptor type III
    see all
  • Function

    Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab215015 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215015.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up