Overview

  • Product name
    Recombinant Human LUC7L protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILA GTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRR TELAKKRLAETQEEISAEVSAKAEKVHELNEEIGKLLAKAEQLGAEGNVD ESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLH DNDRRLADHFGGKLHLGFIQIREKLDQLRKTVAEKQEKRNQDRLRRREER EREERLSRRSGSRTRDRRRSRSRDRRRRRSRSTSRERRKLSRSRSRDRHR RHRSRSRSHSRGHRRASRDRSAKYK
    • Amino acids
      1 to 325
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163179 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • LUC7L1
    • FLJ10231
    • hLuc7B1
    • Luc7
    • LUC7 LIKE
    • LUC7 like (S. cerevisiae)
    • LUC7B1
    • putative RNA binding protein Luc7 like 1
    • Putative RNA binding protein Luc7 like 1 (SR 89) (Putative SR protein LUC7B1)
    • putative SR protein LUC7B1
    • Sarcoplasmic reticulum protein LUC7B1
    • SR 89
    • SR+89
    see all
  • Relevance
    The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5 prime splice site selection. The LUC7L protein may bind to RNA via its Arg/Ser-rich domain.
  • Cellular localization
    Nuclear

Images

  • ab163179 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163179 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163179.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up