Description

  • Product name

    Recombinant Human Lumican protein (denatured)
    See all Lumican proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPMG SSHHHHHHSSGLVPRGSHMGSQYYDYDFPLSIYGQSSPNCAPECNCPESY PSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLIL DHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHN KITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIA RLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIP GNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKI LGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLNGIKYLYLRN NQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINH NNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDA VSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYF KRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNEN LENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDM YECLRVANEVTLN
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      19 to 338
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NCBI Accession No.: NP_002336

Specifications

Our Abpromise guarantee covers the use of ab174455 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 2.4% Urea, 10% Glycerol

General Info

  • Alternative names

    • Keratan sulfate proteoglycan lumican
    • KSPG lumican
    • LDC
    • LUM
    • LUM_HUMAN
    • Lumican
    • Lumican precursor
    • SLRR2D
    see all
  • Tissue specificity

    Cornea and other tissues.
  • Sequence similarities

    Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class II subfamily.
    Contains 11 LRR (leucine-rich) repeats.
    Contains 1 LRRNT domain.
  • Developmental stage

    Present in the extracellular matrix of human articular cartilage at all ages, although its abundance is far greater in the adult. In the adult cartilage lumican exists predominantly in a glycoprotein form lacking keratan sulfate, whereas the juvenile form of the molecule is a proteoglycan.
  • Post-translational
    modifications

    Sulfated on tyrosine residue(s).
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab174455 (3 µg)

References

ab174455 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174455.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up