Description

  • Product name

    Recombinant Human LY6G6D protein (Tagged)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHP ACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      20 to 104
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 10xHis-B2M-tagged. Full length mature chain without signal peptide and without propeptide.

Specifications

Our Abpromise guarantee covers the use of ab235809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • LY66D_HUMAN
    • Ly6g6d
    • Lymphocyte antigen 6 complex locus protein G6d
    • Megakaryocyte-enhanced gene transcript 1 protein
    • Protein Ly6-D
    see all
  • Tissue specificity

    Expressed in the adult lung, and in fetal liver, lung, kidney, brain and spleen.
  • Sequence similarities

    Contains 1 UPAR/Ly6 domain.
  • Post-translational
    modifications

    O-glycosylated.
  • Cellular localization

    Cell membrane. Cell projection > filopodium.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab235809.

References

ab235809 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up