Description

  • Product name

    Recombinant human Lymphotactin/ATAC protein
    See all Lymphotactin/ATAC proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. Determined by its ability to chemoattract Human T cells using a concentration range of 10.0-100.0 ng/ml.

  • Purity

    > 97 % SDS-PAGE.
    > 97 % by HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADP QATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
    • Predicted molecular weight

      10 kDa
    • Amino acids

      23 to 114
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab202785 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as Lymphotactin

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

    0.2 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • ATAC
    • C motif chemokine 1
    • Chemokine (C motif) ligand 1
    • Chemokine C Motif Ligand 1
    • Cytokine SCM-1
    • LPTN
    • LTN
    • Lymphotactin
    • Lymphotaxin
    • SCM 1
    • SCM 1 alpha
    • SCM 1a
    • SCM-1-alpha
    • SCM1
    • SCM1A
    • SCYC1
    • Single cysteine motif 1a
    • Small inducible cytokine C1
    • Small Inducible Cytokine Subfamily C Member 1
    • Small inducible cytokine subfamily C, member 1 (lymphotactin)
    • Small-inducible cytokine C1
    • X-C motif chemokine ligand 1
    • XC chemokine ligand 1
    • Xcl1
    • XCL1_HUMAN
    see all
  • Function

    Chemotactic activity for lymphocytes but not for monocytes or neutrophils.
  • Tissue specificity

    Highest level in spleen, lower in peripheral leukocytes and very low levels in lung, colon and small intestine.
  • Sequence similarities

    Belongs to the intercrine gamma family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab202785 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202785.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up