Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIK YICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALI DQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRA SFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTF KTYEGMMHSSCQQEMMDVKQFIDKLLPPID
    • Molecular weight

      25 kDa
    • Amino acids

      1 to 230
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab151829 is greater than 95% pure, as determined by SEC-HPLC.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • Acyl protein thioesterase 1
    • Acyl-protein thioesterase 1
    • APT 1
    • APT-1
    • APT1
    • hAPT1
    • LPL-I
    • LPL1
    • LYPA1_HUMAN
    • LYPLA 1
    • LYPLA1
    • Lysophospholipase 1
    • Lysophospholipase I
    • Lysophospholipid specific lysophospholipase
    • LYSOPLA
    • LysoPLA I
    see all
  • Function

    Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity and also low lysophospholipase activity.
  • Sequence similarities

    Belongs to the AB hydrolase 2 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab151829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up