Description

  • Product name

    Recombinant Human LZTR2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MELWAPQRLPQTRGKATAPSKDPDRGFRRDGHHRPVPHSWHNGERFHQWQ DNRGSPQPQQEPRADHQQQPHYASRPGDWHQPVSGVDYYEGGYRNQLYSR PGYENSYQSYQSPTMREEYAYGSYYYHGHPQWLQEERVPRQRSPYIWHED YREQKYLDEHHYENQHSPFGTNSETHFQSNSRNPCKDSPASNSGQEWPGE LFPGSLLAEAQKNKPSLASESNLLQQRESGLSSSSYELSQYIRDAPERDD PPASAAWSPVQAEDVSSAGPKAPMKFYIPHVPVSFGPGGQLVRVGPSSPT DGQAALVELHSMEVILNDSEEQEEMRSFSGPLIREDVHKVDIMTFCQQKA AQSCKSETLGSRDSALLWQLLVLLCRQNGSMVGSDIAELLMQDCKKLEKY KRQPPVANLINLTDEDWPVLSSGTPNLLTGEIPPSVETPAQIVEKFTRLL YYGRKKEALEWAMKNHLWGHALFLSSKMDPQTYSWVMSGFTSTLALNDPL QTLFQLMSGRIPQAATCCGEKQWGDWRPHLAVILSNQAGDPELYQRAIVA IGDTLAGKGLVEAAHFCYLMAHVPFGHYTVKTDHLVLLGSSHRYATWEKG NSKDIFQGTVLALVGFYGSSFHFLM
    • Amino acids

      1 to 625
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp686C2486
    • FLJ23871
    • FLJ25761
    • FLJ33652
    • FLJ36620
    • KIAA1928
    • Leucine zipper transcription regulator 2
    • LZTR 2
    • PGPR p117
    • Protein SEC16 homolog B
    • Protein transport protein Sec16B
    • Regucalcin gene promoter region related protein
    • Regucalcin gene promoter region related protein p117
    • Regucalcin gene promoter region-related protein p117
    • RGPR
    • RGPR p117
    • RGPR-p117
    • SC16B_HUMAN
    • SEC16 homolog B
    • SEC16 homolog B (S. cerevisiae)
    • SEC16B
    • SEC16S
    see all
  • Function

    Required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus and for normal transitional endoplasmic reticulum (tER) organization.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the SEC16 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab164789 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164789 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up