Overview

  • Product name

    Recombinant Human LZTS1/FEZ1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      ERQGHDQMSSGFQHERLVWKEEKEKVIQYQKQLQQSYVAMYQRNQRLEKA LQQLARGDSAGEPLEVDLEGADIPYEDIIATEI
    • Amino acids

      514 to 596
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161339 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as LZTS1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • F37
    • F37/esophageal cancer related gene coding leucine zipper motif
    • F37/esophageal cancer-related gene-coding leucine-zipper motif
    • Fez1
    • Leucine zipper putative tumor suppressor 1
    • Lzts1
    • LZTS1_HUMAN
    • Psdzip70
    see all
  • Function

    Involved in the regulation of cell growth. May stabilize the active CDC2-cyclin B1 complex and thereby contribute to the regulation of the cell cycle and the prevention of uncontrolled cell proliferation. May act as a tumor suppressor.
  • Tissue specificity

    Highly expressed in testis, prostate, spleen, thymus, ovary and brain. Detected at lower levels in heart, placenta, small intestine, colon, liver, kidney, skeletal muscle and pancreas. Not detectable in primary tumors from breast and prostate and in many cancer cell lines.
  • Sequence similarities

    Belongs to the LZTS family.
  • Post-translational
    modifications

    Phorphorylated on serine residues. Hyperphosphorylated by the cAMP-dependent kinase PKA during cell-cycle progression.
  • Cellular localization

    Cytoplasm. Cell membrane. Cell projection > dendritic spine. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Cell junction > synapse. Associated with the plasma membrane and with microtubules. Detected in dendritic spines, especially in the postsynaptic density.
  • Information by UniProt

Images

  • ab161339 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161339 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161339.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up