Recombinant Human LZTS2 protein (ab164592)

Overview

  • Product name

    Recombinant Human LZTS2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAIVQTLPVPLEPAPEAATAPQAPVMGSVSSLISGRPCPGGPAPPRHHGP PGPTFFRQQDGLLRGGYEAQEPLCPAVPPRKAVPVTSFTYINEDFRTESP PSPSSDVEDAREQRAHNAHLRGPPPKLIPVSGKLEKNMEKILIRPTAFKP VLPKPRGAPSLPSFMGPRATGLSGSQGSLTQLFGGPASSSSSSSSSSAAD KPLAFSGWASGCPSGTLSDSGRNSLSSLPTYSTGGAEPTTSSPGGHLPSH GSGRGALPGPARGVPTGPSHSDSGRSSSSKSTGSLGGRVAGGLLGSGTRA SPDSSSCGERSPPPPPPPPSDEALLHCVLEGKLRDREAELQQLRDSLDEN EATMCQAYEERQRHWQREREALREDCAAQAQRAQRAQQLLQLQVFQLQQE KRQLQDDFAQLLQEREQLERRCATLEREQRELGPRLEETKWEVCQKSGEI SLLKQQLKESQAELVQKGSELVALRVALREARATLRVSEGRARGLQEAAR ARELELEACSQELQRHRQEAEQLREKAGQLDAEAAGLREPPVPPATADPF LLAESDEAKVQRAAAGVGGSLRAQVERLRVELQRERRRGEEQRDSFEGER LAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELADL GLAEQAPCICLEEITATEI
    • Amino acids

      1 to 669
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164592 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • hLZTS2
    • KIAA1813
    • LAPSER1
    • Leucine zipper putative tumor suppressor 2
    • LZTS2
    • LZTS2_HUMAN
    • OTTHUMP00000020289
    • Protein LAPSER1
    • RP11-108L7.8
    see all
  • Function

    Negative regulator of katanin-mediated microtubule severing and release from the centrosome. Required for central spindle formation and the completion of cytokinesis. May negatively regulate axonal outgrowth by preventing the formation of microtubule bundles that are necessary for transport within the elongating axon. Negative regulator of the Wnt signaling pathway. Represses beta-catenin-mediated transcriptional activation by promoting the nuclear exclusion of beta-catenin.
  • Tissue specificity

    Highly expressed in prostate and testis, and at slightly lower levels in spleen, thymus, uterus, small intestine and colon.
  • Sequence similarities

    Belongs to the LZTS2 family.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton > centrosome. Localized to the centrosome throughout the cell cycle. Localized to the midbody in cells undergoing cytokinesis.
  • Information by UniProt

Images

  • ab164592 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164592 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164592.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up