Description

  • Product name

    Recombinant human M-CSF protein
    See all M-CSF proteins and peptides
  • Biological activity

    The ED50 as determined by the dose-dependant stimulation of the proliferation of mouse M-NSF-60 cells is less than 3.0 ng/ml.

  • Purity

    > 95 % SDS-PAGE.
    assessed also by HPLC analysis
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYL KKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDK ACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCN NSFAECSSQ
    • Predicted molecular weight

      17 kDa
    • Amino acids

      33 to 181
    • Additional sequence information

      Expression system: Baculovirus infected Silkworm.

Specifications

Our Abpromise guarantee covers the use of ab200281 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 3% Mannitol, 96% Phosphate Buffer

    Lyophilized from a 0.2mm filtered solution

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in sterile distilled water or aqeous buffer containing 0.1%BSA to a concentration of 0.1-1.0 mg/mL.

General Info

  • Alternative names

    • Colony stimulating factor 1
    • Colony stimulating factor 1 (macrophage)
    • Colony stimulating factor macrophage specific
    • CSF 1
    • CSF-1
    • CSF1
    • CSF1_HUMAN
    • Csfm
    • Lanimostim
    • M CSF
    • M-CSF
    • Macrophage colony stimulating factor
    • Macrophage Colony Stimulating Factor 1
    • MCSF
    • MGC31930
    • Processed macrophage colony-stimulating factor 1
    see all
  • Function

    Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. CSF-1 induces cells of the monocyte/macrophage lineage. It plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy.
  • Post-translational
    modifications

    Glycosylation and proteolytic cleavage yield different soluble forms. A high molecular weight soluble form is a proteoglycan containing chondroitin sulfate.
    Isoform 1 is N- and O-glycosylated. Isoform 3 is N-glycosylated.
  • Cellular localization

    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

References

ab200281 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200281.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up