Bioactive grade

Recombinant human M-CSF protein (Active) (Biotin) (ab246167)

Description

  • Product name

    Recombinant human M-CSF protein (Active) (Biotin)
    See all M-CSF proteins and peptides
  • Biological activity

    Immobilized Human M-CSF R, Fc Tag at 2 μg/mL (100 μL/well) can bind ab246167 with a linear range of 0.1-2 ng/mL.

  • Purity

    > 90 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYL KKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDK ACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQD VVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGS SLLPGEQPLHTVDPGSAKQRPPR
    • Predicted molecular weight

      29 kDa including tags
    • Amino acids

      33 to 255
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      AviTag sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246167 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • Colony stimulating factor 1
    • Colony stimulating factor 1 (macrophage)
    • Colony stimulating factor macrophage specific
    • CSF 1
    • CSF-1
    • CSF1
    • CSF1_HUMAN
    • Csfm
    • Lanimostim
    • M CSF
    • M-CSF
    • Macrophage colony stimulating factor
    • Macrophage Colony Stimulating Factor 1
    • MCSF
    • MGC31930
    • Processed macrophage colony-stimulating factor 1
    see all
  • Function

    Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. CSF-1 induces cells of the monocyte/macrophage lineage. It plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy.
  • Post-translational
    modifications

    Glycosylation and proteolytic cleavage yield different soluble forms. A high molecular weight soluble form is a proteoglycan containing chondroitin sulfate.
    Isoform 1 is N- and O-glycosylated. Isoform 3 is N-glycosylated.
  • Cellular localization

    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

Images

  • Immobilized Biotinylated Human M-CSF, His,Avitag at 2 µg/mL (100 µL/well) on streptavidin precoated (0.2 µg/well) plate, can bind Cynomolgus M-CSF R, Fc Tag with a linear range of 1-39 ng/mL.
  • SDS-PAGE - Recombinant human M-CSF protein (Active) (Biotin) (ab246167).

    The gel was stained overnight with Coomassie Blue.

    The protein migrates as 35-48 kDa under reducing conditions due to glycosylation.

  • Immobilized Human M-CSF R, Fc Tag at 2 μg/mL (100 μL/well) can bind ab246167 with a linear range of 0.1-2 ng/mL.

References

ab246167 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246167.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up