Bioactive grade

Recombinant human Macrophage Inflammatory Protein 1 alpha / CCL3 (ab202801)

Description

  • Product name

    Recombinant human Macrophage Inflammatory Protein 1 alpha / CCL3
    See all Macrophage Inflammatory Protein 1 alpha / CCL3 proteins and peptides
  • Biological activity

    Determined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 ng/ml.

  • Purity

    > 96 % SDS-PAGE.
    > 96 % by HPLC analysis.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQV CADPSEEWVQKYVSDLELSA
    • Predicted molecular weight

      8 kDa
    • Amino acids

      23 to 92
    • Additional sequence information

      This product is the mature full length protein from aa 23 to 92. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab202801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.58% Sodium chloride, 99% Phosphate Buffer

    Lyophilised from a 0.2mm filtered concentrated solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at -20°C to -70°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • C C motif chemokine 3
    • CCL 3
    • CCL3
    • CCL3_HUMAN
    • Chemokine (C C motif) ligand 3
    • Chemokine C C motif ligand 3
    • Chemokine ligand 3
    • G0/G1 switch regulatory protein 19 1
    • G0/G1 switch regulatory protein 19-1
    • G0S19 1
    • G0S19 1 protein
    • Heparin binding chemotaxis protein
    • L2G25B
    • LD78 alpha
    • LD78-alpha(4-69)
    • LD78alpha
    • Macrophage inflammatory protein 1 alpha
    • Macrophage inflammatory protein 1-alpha
    • macrophage inflammatory protein 1a
    • MIP 1 alpha
    • MIP 1A
    • MIP-1-alpha
    • MIP-1-alpha(4-69)
    • MIP1 alpha
    • MIP1A
    • PAT 464.1
    • SCYA 3
    • SCYA3
    • SIS alpha
    • SIS beta
    • SIS-beta
    • Small inducible cytokine A3
    • small inducible cytokine A3 (homologous to mouse Mip-1a)
    • Small-inducible cytokine A3
    • Tonsillar lymphocyte LD78 alpha protein
    see all
  • Function

    Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    N-terminal processed form LD78-alpha(4-69) is produced by proteolytic cleavage after secretion from HTLV1-transformed T-cells.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab202801 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202801.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up