Recombinant Human Macrophage Inflammatory Protein 3 alpha (Fc Chimera) (ab216229)

Description

  • Product name

    Recombinant Human Macrophage Inflammatory Protein 3 alpha (Fc Chimera)
    See all Macrophage Inflammatory Protein 3 alpha proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 5.000 Eu/mg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCAN PKQTWVKYIV RLLSKKVKNM
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      27 to 96
    • Additional sequence information

      Extracellular domain (aa 27-96) fused to the N-terminus of the Fc region of Human IgG1. This product is for the mature full length protein. The signal peptide is not included (AAH20698.1).

Specifications

Our Abpromise guarantee covers the use of ab216229 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.

    Constituent: 100% PBS

  • Reconstitution
    Reconstitute vial in 50µl sterile water. Add 1X PBS to the desired protein concentration.

General Info

  • Alternative names

    • Beta chemokine exodus 1
    • Beta-chemokine exodus-1
    • C C motif chemokine ligand 20
    • C-C motif chemokine 20
    • CC chemokine LARC
    • Ccl20
    • CCL20(2-70)
    • CCL20_HUMAN
    • Chemokine (C C motif) ligand 20
    • Chemokine C-C motif chemokine 20
    • Chemokine CC motif ligand 20
    • CKb4
    • Exodus
    • Exodus 1
    • LARC
    • Liver and activation regulated chemokine
    • Liver and activation-regulated chemokine
    • Macrophage inflammatory protein 3 alpha
    • MIP 3 alpha
    • MIP 3A
    • MIP-3-alpha
    • MIP-3a
    • MIP3 alpha
    • MIP3A
    • SCYA20
    • Small inducible cytokine A20
    • Small inducible cytokine subfamily A (Cys Cys) member 20
    • Small-inducible cytokine A20
    • ST38
    see all
  • Function

    Chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Inhibits proliferation of myeloid progenitors in colony formation assays. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells. C-terminal processed forms have been shown to be equally chemotactically active for leukocytes. Possesses antibacterial activity E.coli ATCC 25922 and S.aureus ATCC 29213.
  • Tissue specificity

    Expressed predominantly in the liver, lymph nodes, appendix, peripheral blood lymphocytes, and fetal lung. Low levels seen in thymus, prostate, testis, small intestine and colon.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    C-terminal processed forms which lack 1, 3 or 6 amino acids are produced by proteolytic cleavage after secretion from peripheral blood monocytes.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab216229 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216229.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up