Bioactive grade

Recombinant human Macrophage inflammatory protein 5 (ab202788)

Description

  • Product name

    Recombinant human Macrophage inflammatory protein 5
    See all Macrophage inflammatory protein 5 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. Determined by its ability to chemoattract Human T lymphocytes using a concentration range of 1.0 -10.0 ng/ml. 

  • Purity

    > 97 % SDS-PAGE.
    > 97 % by HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYF ETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
    • Predicted molecular weight

      10 kDa
    • Amino acids

      22 to 113
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab202788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.58% Sodium chloride, 99% Phosphate Buffer

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • C-C motif chemokine 15
    • C-C motif chemokine ligand 15
    • CC chemokine 3
    • CCL15
    • CCL15(29-92)
    • CCL15_HUMAN
    • Chemokine (C C motif) ligand 15
    • Chemokine CC-2
    • Chemokine CC2
    • HCC-2
    • HCC2
    • HMRP 2B
    • HMRP2B
    • Leukotactin 1
    • Leukotactin-1
    • LKN-1
    • LKN1
    • Macrophage inflammatory protein 5
    • MIP 1D
    • MIP-1 delta
    • MIP-1D
    • MIP-5
    • MIP1 delta
    • MIP1d
    • MIP5
    • MRP 2B
    • Mrp-2b
    • Mrp2b
    • NCC 3
    • NCC-3
    • NCC3
    • New CC chemokine 3
    • OTTHUMP00000163955
    • SCYA15
    • SCYL3
    • Small inducible cytokine A15
    • Small inducible cytokine subfamily A (Cys Cys), member 15
    • Small-inducible cytokine A15
    • SY15
    see all
  • Function

    Chemotactic factor that attracts T-cells and monocytes, but not neutrophils, eosinophils, or B-cells. Acts mainly via CC chemokine receptor CCR1. Also binds to CCR3. CCL15(22-92), CCL15(25-92) and CCL15(29-92) are more potent chemoattractants than the small-inducible cytokine A15.
  • Tissue specificity

    Most abundant in heart, skeletal muscle and adrenal gland. Lower levels in placenta, liver, pancreas and bone marrow. CCL15(22-92), CCL15(25-92) and CCL15(29-92) are found in high levels in synovial fluids from rheumatoid patients.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab202788 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up