Bioactive grade

Recombinant human Macrophage Scavenger Receptor I/SR-A protein (Active) (ab174007)

Description

  • Product name

    Recombinant human Macrophage Scavenger Receptor I/SR-A protein (Active)
    See all Macrophage Scavenger Receptor I/SR-A proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA.
    Immobilized ab174007 at 5 µg/ml (100 µl/well) can bind biotinylated advanced glycation endproducts of bovine serum albumin (AGE-BSA) with a linear range of 1 - 150 ng/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEKRIQ HILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEI SKSLISLNTTLLDLQLNIENLNGKIQENTFKQQEEISKLEERVYNVSAEI MAMKEEQVHLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQGPPG PPGEKGDRGPTGESGPRGFPGPIGPPGLKGDRGAIGFPGSRGLPGYAGRP GNSGPKGQKGEKGSGNTLTPFTKVRLVGGSGPHEGRVEILHSGQWGTICD DRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQGTGPIWLNEVFCFGRESSI EECKIRQWGTRACSHSEDAGVTCTL
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      77 to 451
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab174007 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as Macrophage Scavenger Receptor I

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C long term.

    Information available upon request.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD204
    • CD204 antigen
    • CD24
    • Macrophage acetylated LDL receptor I and II
    • Macrophage scavenger receptor 1
    • Macrophage scavenger receptor type III
    • Macrophage scavenger receptor types I and II
    • Msr 1
    • MSR1
    • MSRE_HUMAN
    • phSR1
    • phSR2
    • SCARA 1
    • SCARA1
    • Scavenger receptor class A member 1
    • Scavenger receptor class A, member 1
    • Scavenger receptor type A
    • Scvr
    • SR A
    • SRA
    see all
  • Function

    Membrane glycoproteins implicated in the pathologic deposition of cholesterol in arterial walls during atherogenesis. Two types of receptor subunits exist. These receptors mediate the endocytosis of a diverse group of macromolecules, including modified low density lipoproteins (LDL). Isoform III does not internalize actetylated LDL.
  • Tissue specificity

    Isoform I, isoform II and isoform III are expressed in monocyte-derived macrophages.
  • Sequence similarities

    Contains 1 collagen-like domain.
    Contains 1 SRCR domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Reduced SDS-PAGE analysis of ab174007 staining overnight with Coomassie Blue.

    DTT-reduced Protein migrates as 65-72 kDa due to glycosylation.

References

ab174007 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174007.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up