Description

  • Product name

    Recombinant Human Mad2L1 protein (His tag)
    See all Mad2L1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYG LTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERW QFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCS FDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYK IPVND
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      1 to 205
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab221308 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C..

    pH: 7.40
    Constituents: 5% Trehalose, 95% PBS

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • HsMAD 2
    • HsMAD2
    • MAD 2
    • MAD 2A
    • MAD2 like 1
    • MAD2 like protein 1
    • MAD2 mitotic arrest deficient like 1
    • MAD2-like protein 1
    • Mad2l1
    • MD2L1_HUMAN
    • Mitotic arrest deficient 2-like protein 1
    • Mitotic arrest deficient yeast homolog like 1
    • Mitotic spindle assembly checkpoint protein MAD2A
    see all
  • Function

    Component of the spindle-assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. Required for the execution of the mitotic checkpoint which monitors the process of kinetochore-spindle attachment and inhibits the activity of the anaphase promoting complex by sequestering CDC20 until all chromosomes are aligned at the metaphase plate.
  • Sequence similarities

    Belongs to the MAD2 family.
    Contains 1 HORMA domain.
  • Domain

    The protein has two highly different native conformations, an inactive open conformation that cannot bind CDC20 and that predominates in cytosolic monomers, and an active closed conformation. The protein in the closed conformation preferentially dimerizes with another molecule in the open conformation, but can also form a dimer with a molecule in the closed conformation. Formation of a heterotetrameric core complex containing two molecules of MAD1L1 and of MAD2L1 in the closed conformation promotes binding of another molecule of MAD2L1 in the open conformation and the conversion of the open to the closed form, and thereby promotes interaction with CDC20.
  • Post-translational
    modifications

    Phosphorylated on multiple serine residues. The level of phosphorylation varies during the cell cycle and is highest during mitosis. Phosphorylation abolishes interaction with MAD1L1 and reduces interaction with CDC20.
  • Cellular localization

    Nucleus. Chromosome > centromere > kinetochore. Cytoplasm. Recruited by MAD1L1 to unattached kinetochores (Probable). Recruited to the nuclear pore complex by TPR during interphase. Recruited to kinetochores in late prometaphase after BUB1, CENPF, BUB1B and CENPE. Kinetochore association requires the presence of NEK2. Kinetochore association is repressed by UBD.
  • Information by UniProt

Images

  • Analysis of ab221308 by DTT-reduced SDS-PAGE and staining overnight with Coomassie Blue.

    DTT-reduced protein migrates as 24 kDa.

     

     

References

ab221308 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221308.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up