Description

  • Product name

    Recombinant Human MAD3 protein
    See all MAD3 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQ APGAQDSGRSVHNELEKRRRAQLKRCLERLKQQMPLGADCARYTTLSLLR RARMHIQKLEDQEQRARQLKERLRSKQQSLQRQLEQLRGLAGAAERERLR ADSLDSSGLSSERSDSDQEELEVDVESLVFGGEAELLRGFVAGQEHSYSH GGGAWL
    • Predicted molecular weight

      50 kDa including tags
    • Amino acids

      1 to 206

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • bHLHc13
    • Class C basic helix-loop-helix protein 13
    • FLJ35523
    • Likely ortholog of mouse Max dimerization protein 3
    • MAD3_HUMAN
    • MAX dimerization protein 3
    • Max dimerizer 3
    • Max-associated protein 3
    • Max-interacting transcriptional repressor MAD3
    • MGC2383
    • mxd3
    • Myx
    • OTTHUMP00000223596
    • OTTHUMP00000223598
    see all
  • Function

    Transcriptional repressor. Binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab131940 at approximately 49.9 kDa.
    Stained with Coomassie Blue.

References

ab131940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up