Description

  • Product name

    Recombinant Human MADM protein
  • Purity

    > 90 % SDS-PAGE.
    assessed by densitometry
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSEGESQTVLSSGSDPKVESSSSAPGLTSVSPPVTSTTSAASPEEEEESE DESEILEESPCGRWQKRREEVNQRNVPGIDSAYLAMDTEEGVEVVWNEVQ FSERKNYKLQEEKVRAVFDNLIQLEHLNIVKFHKYWADIKENKARVIFIT EYMSSGSLKQFLKKTKKNHKTMNEKAWKRWCTQILSALSYLHSCDPPIIH GNLTCDTIFIQHNGLIKIGSVAPDTINNHVKTCREEQKNLHFFAPEYGEV TNVTTAVDIYSFGMCALEMAVLEIQGNGESSYVPQEAISSAIQLLEDPLQ REFIQKCLQSEPARRPTARELLFHPALFEVPSLKLLAAHCIVGHQHMI PENALEEITKNMDTSAVLAEIPAGPGREPVQTLYSQSPALELDKFLEDVR NGIYPLTAFGLPRPQQPQQEEVTSPVVPPSVKTPTPEPAEVETRKVVLMQ CNIESVEEGVKHHLTLLLKLEDKLNRHLSCDL MPNENIPELAAELVQL GFISEADQSRLTSLLEETLNKFNFARNSTLNSAAVTVSS
    • Predicted molecular weight

      92 kDa including tags
    • Amino acids

      1 to 535
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab204143 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 25% Glycerol, 0.87% Sodium chloride, 0.002% PMSF, 0.004% DTT, 0.31% Glutathione, 0.003% EDTA

General Info

  • Alternative names

    • BCON3
    • MADM
    • MUDPNP
    • Multiple domain putative nuclear protein
    • Myeloid leukemia factor 1 adaptor molecule
    • NRBP
    • NRBP_HUMAN
    • NRBP1
    • Nuclear receptor binding protein
    • Nuclear receptor-binding protein
    see all
  • Function

    May play a role in subcellular trafficking between the endoplasmic reticulum and Golgi apparatus through interactions with the Rho-type GTPases. Binding to the NS3 protein of dengue virus type 2 appears to subvert this activity into the alteration of the intracellular membrane structure associated with flaviviral replication.
  • Tissue specificity

    Ubiquitously expressed in all tissues examined with high levels in the testis.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Domain

    The protein kinase domain is predicted to be catalytically inactive.
  • Cellular localization

    Cytoplasm > cell cortex. Endomembrane system. Cell projection > lamellipodium. Colocalizes with activated RAC3 to endomembranes and at the cell periphery in lamellipodia.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab204143.

References

ab204143 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204143.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up