Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSVDPLSSKALKIKRELSENTPHLSDEALMGLSVRELNRHLRGLSAEEVT RLKQRRRTLKNRGYAASCRVKRVCQKEELQKQKSELEREVDKLARENAAM RLELDALRGK
    • Amino acids
      1 to 110
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161761 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Avian musculoaponeurotic fibrosarcoma virus (v maf) AS42 oncogene, protein F
    • CTA 447C4.1
    • hMafF
    • MAFF
    • MAFF_HUMAN
    • OTTHUMP00000199299
    • Transcription factor MafF
    • U MAF
    • U-Maf
    • V maf avian musculoaponeurotic fibrosarcoma oncogene family, protein F
    • V maf musculoaponeurotic fibrosarcoma oncogene homolog F
    • V maf musculoaponeurotic fibrosarcoma oncogene homolog F (avian)
    • V-maf musculoaponeurotic fibrosarcoma oncogene homolog F
    see all
  • Function
    Interacts with the upstream promoter region of the oxytocin receptor gene. May be a transcriptional enhancer in the up-regulation of the oxytocin receptor gene at parturition. Since it lacks a putative transactivation domain, it may behave as a transcriptional repressor when it dimerize among himself. May also serve as a transcriptional activator by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. May be involved in the cellular stress response.
  • Tissue specificity
    Expressed in the term myometrium and kidney.
  • Sequence similarities
    Belongs to the bZIP family. Maf subfamily.
    Contains 1 bZIP domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161761 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161761 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161761.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up