Description

  • Product name

    Recombinant Human MAGD4 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MIKDYKKIPIKRADMLKDVIREYDEHFPEIIERATYTLEKKFGIHLKEID KEEHLYILVCTRDSSARLLGKTKDTPRLSLLLVILGVIFMNGNRASEAVL WEALRKMGLRPGVRHPFLGDLRKLITDDFVKQKNPELREETPLSMAPSWY LEYKKIPNSNPPEYEFLWGLRARHETSKMRVLRFIAQNQNRDPREWKAHF LEAVDDAFKTMDVDMAEEHARAQMRAQMNIGDEALIGRWSWDDIQVELLT WDEDGDFGDAWARIPFAFWARYHQYILNSNRANRRATWRAGVSSGTNGGA STSVLDGPSTSSTIRTRNAARAGASFFSWIQHR
    • Amino acids

      1 to 333
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164336 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MAGD4_HUMAN
    • MAGE-D4 antigen
    • MAGE-E1 antigen
    • MAGED4B
    • Melanoma-associated antigen D4
    see all
  • Function

    May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex.
  • Tissue specificity

    Expressed only in brain and ovary among normal tissues. Isoform 1 and isoform 2 are specifically expressed in glioma cells among cancer cells. Detected in some renal cell carcinoma samples.
  • Sequence similarities

    Contains 1 MAGE domain.
  • Information by UniProt

Images

  • ab164336 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164336 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164336.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up