Overview

  • Product name

    Recombinant Human MAGEA10 protein (His tag)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPS SFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASL PLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQ MKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHS FVLVTSLGLTYDGMLSDVQSMPKTGILILILSIVFIEGYCTPEEVIWEAL NMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP RAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDD TTAMASASSSATGSFSYPE
    • Molecular weight

      46 kDa including tags
    • Amino acids

      1 to 369
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 10xHis-tagged.

Specifications

Our Abpromise guarantee covers the use of ab235805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Cancer/testis antigen 1.10
    • cancer/testis antigen family 1, member 10
    • CT1.10
    • MAGE 10 antigen
    • MAGE10
    • Melanoma antigen family A 10
    • Melanoma associated antigen 10
    see all
  • Relevance

    This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. MAGEA10 contains one MAGE domain. Its function is not known, though it may play a role in embryonal development and tumor transformation or aspects of tumor progression. MAGEA10 is expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes and placenta.

Images

  • ab235805 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab235805 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235805.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up