Description

  • Product name

    Recombinant Human MAGEA11 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPLEQRSQHCKPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTL EELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPD LIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYF PEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYDGIQCNEQSMP KSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLT QNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRD PTSYPSLYEDALREEGEGV
    • Amino acids

      1 to 319
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cancer/testis antigen 1.11
    • cancer/testis antigen family 1, member 11
    • CT1.11
    • MAGE 11
    • MAGE 11 antigen
    • MAGE11
    • MAGEA 11
    • Melanoma antigen family A 11
    • Melanoma associated antigen 11
    • MGC10511
    see all
  • Relevance

    MAGEA11 (Melanoma antigen family A, 11) is a member of the MAGEA gene family. MAGEA proteins are expressed in melanomas and other cancers. MAGEA11 acts as androgen receptor co-regulator increasing androgen receptor activity by modulating the receptors interdomain interaction.
  • Cellular localization

    Cytoplasmic and Nuclear

Images

  • ab158846 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158846 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up