Description

  • Product name

    Recombinant Human MAGEA9 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSLEQRSPHCKPDEDLEAQGEDLGLMGAQEPTGEEEETTSSSDSKEEE VSAAGSSSPPQSPQGGASSSISVYYTLWSQFDEGSSSQEEEEPSSSVDPA QLEFMFQEALELKVAELVHFLLHKYRVKEPVTKAEMLESVIKNYKRYFPV IFGKASEFMQVIFGTDVKEVDPAGHSYILVTALGLSCDSMLGDGHSMPKA ALLIIVLGVILTKDNCAPEEVIWEALSVMGVYVGKEHMFYGEPRKLLTQD WVQENYLEYRQVPGSDPAHYEFLWGSKAHAETSYEKVINYLVMLNAREPI CYPSLYEEVLGEEQEGV
    • Predicted molecular weight

      61 kDa including tags
    • Amino acids

      1 to 315

Specifications

Our Abpromise guarantee covers the use of ab116810 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names

    • Cancer/testis antigen 1.9
    • Cancer/testis antigen family 1 member 9
    • CT1.9
    • MAGA9_HUMAN
    • MAGE 9 antigen
    • MAGE-9 antigen
    • MAGE9
    • MAGEA9A
    • MAGEA9B
    • Melanoma antigen family A 9
    • Melanoma associated antigen 9
    • Melanoma-associated antigen 9
    • MGC8421
    see all
  • Function

    Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.
  • Tissue specificity

    Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes and placenta.
  • Sequence similarities

    Contains 1 MAGE domain.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116810 at approximately 60.76kDa.
    Stained with Coomassie Blue.

References

ab116810 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116810.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up