Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMPRGQKSKLRAREKRRQARGGLEDLID ALDILEEEEESPPSASACLKDVFQSSLDGASNNPHGLREAQSTSTSATAA SHTRHPEGVNDQMEERPICTQDLEATDSFP RGPVDEKVIILVHYLLYKYQMKEPITKADMLRNVTQMSKSQFPVILSRAS EHLELIFGLDLKEVEPNKHIYVLVNKLDLGCDAKLSDETGVPKTGLLMTV LGIIFTNGNCVAEEEVWKVFNTMGLYDGIEHFMFGEPRKLLTKDLVKENY LEYQQVPNSDPPRYQFLWGPRAHAETSKMKVLEFLAKVNDTAPSEFSNWY TEALQDEEERARARVAAKAR VSATAGARSKVKSSKSSQLQ
    • Molecular weight
      41 kDa including tags
    • Amino acids
      1 to 347
    • Tags
      His tag N-Terminus
    • Additional sequence information
      (NP_872312).

Specifications

Our Abpromise guarantee covers the use of ab176031 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab176031 is purified using conventional chromatography techniques
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • FLJ32965
    • MAGBA_HUMAN
    • MAGE B10 antigen
    • MAGE family testis and tumor specific protein
    • MAGE-B10 antigen
    • MAGEB10
    • melanoma antigen family B, 10
    • Melanoma associated antigen B10
    • Melanoma-associated antigen B10
    • MGC120394
    • OTTHUMP00000043236
    see all
  • Sequence similarities
    Contains 1 MAGE domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab176031 (3µg).

References

ab176031 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176031.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up