Description

  • Product name

    Recombinant Human MAGEB18 protein
  • Purity

    > 90 % SDS-PAGE.
    The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFPRGQKSKLRAREKRHQARCEN QDLGATQATVAEGESPSSAYLLFGDRPQNLPAAETPSIPEALQGAPSTTN AIAPVSCSSNEGASSQDEKSLGSSREAEGWKEDPLNKKVVSLVHFLLQKY ETKEPITKGDMIKFVIRKDKCHFNEILKRASEHMELALGVDLKEVDPIRH YYAFFSKLDLTYDETTSDEEKIPKTGLLMIALGVIFLNGNRAPEEAVWEI MNMMGVYADRKHFLYGDPRKVMTKDLVQLKYLEYQQVPNSDPPRYEFLWG PRAHAETSKMKVLEFVAKIHDTVPSAFPSCYEEALRDEEQRTQARAAARA HTAAMANARSRTTSSSFSHAK
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      2 to 343
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      NP_775970.1. Constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab190318 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituent: 0.32% Tris HCl

    also contains NaCl, KCl, EDTA, arginine, DTT and Sucrose.

General Info

  • Alternative names

    • B430216B18Rik
    • MAGBI_HUMAN
    • MAGE-B18 antigen
    • MAGEB18
    • MAGEB18 antigen
    • Melanoma antigen family B, 18
    • Melanoma-associated antigen B18
    • MGC114496
    • RGD1560369
    • RP23-289C5.3
    see all
  • Sequence similarities

    Contains 1 MAGE domain.
  • Information by UniProt

References

ab190318 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190318.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up