Recombinant Human MAGEB2 protein (ab158850)

Overview

  • Product name
    Recombinant Human MAGEB2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAA SSSPAAGIPQKPQRAPTTAAAAAAGVSSTKSKKGAKSHQGEKNASSSQAS TSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKIVGKRFREHFP EILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPR RKLLMPLLGVIFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITK DLVQEKYLEYKQVPSSDPPRFQFLWGPRAYAETSKMKVLEFLAKVNGTTP CAFPTHYEEALKDEEKAGV
    • Amino acids
      1 to 319
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158850 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 3.2
    • Cancer/testis antigen family 3, member 2
    • CT3.2
    • DAM6
    • DSS AHC critical interval MAGE superfamily 6
    • DSS/AHC critical interval gene, from MAGE superfamily, 6
    • MAGE B2 antigen
    • MAGE XP 2
    • MAGE XP 2 antigen
    • Mage-b2
    • Mage-rs2
    • melanoma antigen family B, 2
    • Melanoma antigen, family B, 1
    • Melanoma associated antigen B2
    • MGC2643
    • MGC26438
    • Smage-2 protein
    • Smage2
    see all
  • Relevance
    MAGEB2 is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. This gene is localized in the DSS (dosage-sensitive sex reversal) critical region. It is expressed in testis and placenta, and in a significant fraction of tumors of various histological types. The MAGEB genes are clustered on chromosome Xp22-p21.

Images

  • ab158850 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158850 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158850.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up