Description

  • Product name

    Recombinant Human MAGEC2 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AELVEFLLLKYEAEEPVTEAEMLMIVIKYKDYFPVILKRAREFMELLFGL ALIEVGPDHFCVFANTVGLTDEGSDDE
    • Amino acids

      146 to 222
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162551 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cancer testis antigen 10
    • Cancer/testis antigen 10
    • CT10
    • HCA587
    • Hepatocellular cancer antigen 587
    • Hepatocellular carcinoma associated antigen 587
    • Hepatocellular carcinoma-associated antigen 587
    • MAGC2_HUMAN
    • MAGE C2 antigen
    • MAGE E1 antigen
    • MAGE family member C2
    • MAGE-C2 antigen
    • MAGE-E1 antigen
    • MAGEC2
    • Melanoma antigen family C 2
    • Melanoma antigen family C2
    • Melanoma antigen family E 1 cancer/testis specific
    • Melanoma associated antigen C2
    • Melanoma-associated antigen C2
    • MGC13377
    see all
  • Tissue specificity

    Not expressed in normal tissues, except in germ cells in the seminiferous tubules and in Purkinje cells of the cerebellum. Expressed in various tumors, including melanoma, lymphoma, as well as pancreatic cancer, mammary gland cancer, non-small cell lung cancer and liver cancer. In hepatocellular carcinoma, there is a inverse correlation between tumor differentiation and protein expression, i.e. the lower the differentiation, the higher percentage of expression.
  • Sequence similarities

    Contains 1 MAGE domain.
  • Developmental stage

    Strongly expressed in spermatogonia and primary spermatocytes. At later stages of maturation, expression gradually decreases and becomes undetectable in mature spermatids.
  • Cellular localization

    Cytoplasm. Nucleus. Nuclear in germ cells. Cytoplasmic in well-differentiated hepatocellular carcinoma, nuclear in moderately- and poorly-differentiated hepatocellular carcinoma.
  • Information by UniProt

Images

  • ab162551 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162551 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162551.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up