Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAQKMDCGAGLLGFQAEASVEDSALLMQTLMEAIQISEAPPTNQATAAAS PQSSQPPTANEMADIQVSAAAARPKSAFKVQNATTKGPNGVYDFSQAHNA KDVPNTQPKAAFKSQNATPKGPNAAYDFSQAATTGELAANKSEMAFKAQN ATTKVGPNATYNFSQSLNANDLANSRPKTPFKAWNDTTKAPTADTQTQNV NQAKMATSQADIETDPGISEPDGATAQTSADGSQAQNLESRTIIRGKRTR KINNLNVEENSSGDQRRAPLAAGTWRSAPVPVTTQNPPGAPPNVLWQTPL AWQNPSGWQNQTARQTPPARQSPPARQTPPAWQNPVAWQNPVIWPNPVIW QNPVIWPNPIVWPGPVVWPNPLAWQNPPGWQTPPGWQTPPGWQGPPDWQG PPDWPLPPDWPLPPDWPLPTDWPLPPDWIPADWPIPPDWQNLRPSPNLRP SPNSRASQNPGAAQPRDVALLQERANKLVKYLMLKDYTKVPIKRSEMLRD IIREYTDVYPEIIERACFVLEKKFGIQLKEIDKEEHLYILISTPESLAGI LGTTKDTPKLGLLLVILGVIFMNGNRASEAVLWEALRKMGLRPGVRHPLL GDLRKLLTYEFVKQKYLDYRRVPNSNPPEYEFLWGLRSYHETSKMKVLRF IAEVQKRDPRDWTAQFMEAADEALDALDAAAAEAEARAEARTRMGIGDEA VSGPWSWDDIEFELLTWDEEGDFGDPWSRIPFTFWARYHQNARSRFPQTF AGPIIGPGGTASANFAANFGAIGFFWVE
    • Amino acids
      1 to 778
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160516 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DLXIN 1
    • MAGD1_HUMAN
    • MAGE D1 antigen
    • MAGE tumor antigen CCF
    • MAGE-D1 antigen
    • Maged1
    • Melanoma antigen family D 1
    • Melanoma associated antigen D1
    • Melanoma-associated antigen D1
    • Neurotrophin receptor interacting MAGE homolog
    • Neurotrophin receptor-interacting MAGE homolog
    • NRAGE
    • PP2250
    see all
  • Function
    Involved in the apoptotic response after nerve growth factor (NGF) binding in neuronal cells. Inhibits cell cycle progression, and facilitates NGFR-mediated apoptosis. May act as a regulator of the function of DLX family members. May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. Plays a role in the circadian rythm regulation. May act as RORA co-regulator, modulating the expression of core clock genes such as ARNTL/BMAL1 and NFIL3, induced, or NR1D1, repressed.
  • Tissue specificity
    Expressed in bone marrow stromal cells from both multiple myeloma patients and healthy donors. Seems to be ubiquitously expressed.
  • Sequence similarities
    Contains 1 MAGE domain.
  • Cellular localization
    Cytoplasm. Cell membrane. Nucleus. Expression shifts from the cytoplasm to the plasma membrane upon stimulation with NGF.
  • Information by UniProt

Images

  • ab160516 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160516 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160516.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up