Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMQGQYDLDPLPPFPDHVQYTHYSDQID NPDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPG PLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCA HEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC
    • Molecular weight

      22 kDa including tags
    • Amino acids

      18 to 183
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab136704 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 6.01% Urea, 0.32% Tris HCl, 20% Glycerol

General Info

  • Alternative names

    • MAGP
    • MAGP-1
    • MAGP1
    • MFAP-2
    • Mfap2
    • MFAP2_HUMAN
    • Microfibril associated glycoprotein
    • Microfibril-associated glycoprotein 1
    • Microfibrillar associated protein 2
    • Microfibrillar-associated protein 2
    see all
  • Function

    Component of the elastin-associated microfibrils.
  • Sequence similarities

    Belongs to the MFAP family.
    Contains 1 SXC (ShKT) domain.
  • Post-translational
    modifications

    Forms intermolecular disulfide bonds either with other MAGP-1 molecules or with other components of the microfibrils. May form transglutaminase cross-links.
    O-glycosylated.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab136704.

References

ab136704 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab136704.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up