Description

  • Product name

    Recombinant human MAK protein
  • Biological activity

    The specific activity of ab190407 was determined to be 40 nmol/min/mg.

  • Purity

    > 75 % SDS-PAGE.
    assessed by densitometry
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNRYTTMRQLGDGTYGSVLMGKSNESGELVAIKRMKRKFYSWDECMNLRE VKSLKKLNHANVIKLKEVIRENDHLYFIFEYMKENLYQLMKDRNKLFPES VIRNIMYQILQGLAFIHKHGFFHRDMKPENLLCMGPELVKIADFGLAREL RSQPPYTDYVSTRWYRAPEVLLRSSVYSSPIDVWAVGSIMAELYMLRPLF PGTSEVDEIFKICQVLGTPKKSDWPEGYQLASSMNFRFPQCVPINLKTLI PNASNEAIQLMTEMLNWDPKKRPTASQALKHPYFQVGQVLGPSSNHLESK QSLNKQLQPLESKPSLVEVEPKPLPDIIDQVVGQPQPKTSQQPLQPIQPP QNLSVQQPPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTI FKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRLPEPVPSGSNH STGENKSLPAVTSLKSDSELSTAPTSKQYYLKQSRYLPGVNPKKVSLIAS GKEINPHTWSNQLFPKSLGPVGAELAFKRSNAGNLGSYATYNQSGYIPSF LKKEVQSAGQRIHLAPLNATASEYTWNTKTGRGQFSGRTYNPTAKNLNIV NRAQPIPSVHGRTDWVAKYGGHR
    • Predicted molecular weight

      78 kDa including tags
    • Amino acids

      1 to 623
    • Tags

      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab190407 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    Functional Studies

  • Form

    Liquid
  • Additional notes

    ab64311 (Myelin Basic Protein protein) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • intestinal cell kinase
    • dJ417M14.2
    • fj04c02
    • Ick
    • Mak
    • MAK_HUMAN
    • Male germ cell associated kinase
    • Male germ cell-associated kinase
    • male germ cell-associated kinase retinal-enriched isoform
    • OTTHUMP00000016025
    • Rck
    • RP62
    • Serine/threonine protein kinase MAK
    • Serine/threonine-protein kinase MAK
    • testicular secretory protein Li 28
    • wu:fj04c02
    • zgc:56603
    see all
  • Function

    Essential for the regulation of ciliary length and required for the long-term survival of photoreceptors (By similarity). Phosphorylates FZR1 in a cell cycle-dependent manner. Plays a role in the transcriptional coactivation of AR. Could play an important function in spermatogenesis. May play a role in chromosomal stability in prostate cancer cells.
  • Tissue specificity

    Expressed in prostate cancer cell lines at generally higher levels than in normal prostate epithelial cell lines. Isoform 1 is expressed in kidney, testis, lung, trachea, and retina. Isoform 2 is retina-specific where it is expressed in rod and cone photoreceptors.
  • Involvement in disease

    Defects in MAK are the cause of retinitis pigmentosa type 62 (RP62) [MIM:614181]. RP62 is a retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated. Phosphorylated on serine and threonine residues.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton > centrosome. Cytoplasm > cytoskeleton > spindle. Midbody. Cell projection > cilium > photoreceptor outer segment. Photoreceptor inner segment. Localized in both the connecting cilia and the outer segment axonemes (By similarity). Localized uniformly in nuclei during interphase, to the mitotic spindle and centrosomes during metaphase and anaphase, and also to midbody at anaphase until telophase.
  • Information by UniProt

Images

  • The specific activity of ab190407 was determined to be 40 nmol/min/mg.

  • The putity of ab190407 was determined to be >75% by densitometry.

     

References

ab190407 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190407.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up