Overview

  • Product name

    Recombinant Human mAKAP protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      RAEVGKEVNGLPQTSSGCAENLEFTPSKLDSEKESSGKPGESGMPEEHNA ASAKSKVQDLSLKANQPTDKAALHPSPKTLTCEENLLNLHEKRHRNMH
    • Amino acids

      2221 to 2318
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160503 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as AKAP6. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A kinase (PRKA) anchor protein 6
    • A kinase anchor protein 100
    • A kinase anchor protein 100 kDa
    • A kinase anchor protein 6
    • ADAP 100
    • ADAP 6
    • ADAP100
    • ADAP6
    • AKAP 100
    • AKAP 6
    • AKAP100
    • AKAP6
    • Human A kinase anchor protein AKAP100
    • KIAA0311
    • mAKAP
    • PRKA 6
    • PRKA6
    • Protein kinase A anchoring protein 6
    see all
  • Relevance

    The A Kinase Anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. mAKAP is a member of the AKAP family. It is highly expressed in various brain regions and cardiac and skeletal muscle. It is specifically localized to the sarcoplasmic reticulum and nuclear membrane, and is involved in anchoring PKA to the nuclear membrane or sarcoplasmic reticulum.
  • Cellular localization

    Sarcoplasmic reticulum and nuclear membrane in heart muscle.

Images

  • ab160503 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160503 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160503.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up