Description

  • Product name

    Recombinant Human MAL protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPL VQGWVMFVSVFCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYL SASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYVVHAVFSLIRW KSS
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      1 to 153

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • mal
    • MAL protein gene
    • Mal T-cell differentiation protein
    • MAL_HUMAN
    • MALGENE
    • MPV17
    • Myelin and lymphocyte protein
    • T-cell differentiation protein MAL
    • T-lymphocyte maturation-associated protein
    • VIP17
    see all
  • Function

    Could be an important component in vesicular trafficking cycling between the Golgi complex and the apical plasma membrane. Could be involved in myelin biogenesis and/or myelin function.
  • Sequence similarities

    Belongs to the MAL family.
    Contains 1 MARVEL domain.
  • Developmental stage

    Expressed in the intermediate and late stages of T-cell differentiation.
  • Post-translational
    modifications

    Lipoprotein.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab131155 on a 12.5% gel stained with Coomassie Blue.

References

ab132155 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up