Recombinant Human MAN1C1 protein (ab163496)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AEDAKEEKRAHYRELAAQITKTCHESYARSDTKLGPEAFWFNSGREAVAT QLSESYYILRPEVVESYMYLWRQTHNPIYREWGWEVVLALEKYCRTEAGF SGI
    • Amino acids
      463 to 565
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163496 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1 2 alpha mannosidase IC
    • Alpha 1 2 mannosidase IC
    • HMIC
    • MAN1A3
    • MAN1C
    • Mannosidase alpha class 1C member 1
    • Mannosyl oligosaccharide 1 2 alpha mannosidase IC
    • pp6318
    • Processing alpha 1 2 mannosidase IC
    see all
  • Relevance
    MAN1C1 belongs to the glycosyl hydrolase 47 family. It is involved in the maturation of Asn-linked oligosaccharides. It trims alpha-1,2-linked mannose residues from Man(9)GlcNAc(2) to produce first Man(8)GlcNAc(2) then Man(6)GlcNAc and a small amount of Man(5)GlcNAc. MAN1C1 is expressed in most tissues with the exception of lung, muscle and pancreas. It is highly expressed in placenta.
  • Cellular localization
    Golgi apparatus membrane; Single-pass type II membrane protein.

Images

  • ab163496 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163496 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163496.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up