Description

  • Product name

    Recombinant Human MAN2B1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGAYARASGVCARGCLDSAGPWTMSRALRPPLPPLCFFLLLLAAAGARAG GYETCPTVQPNMLNVHLLPHTHDDVGWLKTVDQYFYGIKNDIQHAGVQYI LDSVISALLADPTRRFIYVEIAFFSRWWHQQTNATQEVVRDLVRQGRLEF ANGGWVMNDEAATHYGAIVDQMTLGLRFLEDTFGNDGRPRVAWHIDPFGH SREQASLFAQMGFDGFFFGRLDYQDKWVRMQKLEMEQVWRASTSLKPPTA DLFTGVLPNGYNPPRNLCWDVLCVDQPLVEDPRSPEYNAKELVDYFLNVA TAQGRYYRTNHTVMTMGSDFQYENANMWFKNLDKLIRLVNAQQAKGSSVH VLYSTPACYLWELNKANLTWSVKHDDFFPYADGPHQFWTGYFSSRPALKR YERLSYNFLQVCNQLEALVGLAANVGPYGSGDSAPLNEAMAVLQHHDAVS GTSRQHVANDYARQLAAGWGPCEVLLSNALARLRGFKDHFTFCQQLNISI CPLSQTAARFQVIVYNPLGRKVNWMVRLPVSEGVFVVKDPNGRTVPSDVV IFPSSDSQAHPPELLFSASLPALGFSTYSVAQVPRWKPQARAPQPIPRRS WSPALTIENEHIRATFDPDTGLLMEIMNMNQQLLLPVRQTFFWYNASIGD NESDQASGAYIFRPNQQKPLPVSRWAQIHLVKTPLVQEVHQNFSAWCSQV VRLYPGQRHLELEWSVGPIPVGDTWGKEVISRFDTPLETKGRFYTDSNGR EILERRRDYRPTWKLNQTEPVAGNYYPVNTRIYITDGNMQLTVLTDRSQG GSSLRDGSLELMVHRRLLKDDGRGVSEPLMENGSGAWVRGRHLVLLDTAQ AAAAGHRLLAEQEVLAPQVVLAPGGGAAYNLGAPPRTQFSGLRRDLPPSV HLLTLASWGPEMVLLRLEHQFAVGEDSGRNLSAPVTLNLRDLFSTFTITR LQETTLVANQLREAASRLKWTTNTGPTPHQTPYQLDPANITLEPMEIRTF LASVQWKEVDG
    • Amino acids

      1 to 1011
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158856 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EC 3.2.1.24
    • Laman
    • Lysosomal acid alpha mannosidase
    • Lysosomal alpha mannosidase
    • MANB
    • Mannosidase alpha class 2B member 1
    • Mannosidase, alpha B
    • Mannosidase, alpha B, lysosomal
    see all
  • Relevance

    MAN2B1 is necessary for the catabolism of N-linked carbohydrates released during glycoprotein turnover. It cleaves all known types of alpha-mannosidic linkages.
  • Cellular localization

    Lysosome

Images

  • ab158856 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158856 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158856.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up