For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    By product type
    Proteins and Peptides
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Lysates
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    • Protocols & troubleshooting
    • Technical FAQs
    • Get technical help
    • RabMAb Advantages
    • Buying FAQs
    • Antibody Guide
    • Scientific webinars
    • Biochemical product FAQ
    • Support resources
    • eProcurement
    Check out our protocols

    Visit protocols and troubleshooting or check them out using the Abcam app for iPhone

    Protocols and troubleshooting

    iPhone app

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-human-mannan-binding-lectinmbl-protein-ab151947.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Complement Alternative Pathway
Share by email

Recombinant Human Mannan Binding Lectin/MBL protein (ab151947)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

  • Datasheet
  • References
  • Protocols

Description

  • Product name

    Recombinant Human Mannan Binding Lectin/MBL protein
    See all Mannan Binding Lectin/MBL proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab151947 has purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. 0.2 µM filtered.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

    P11226
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQ GPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAE NGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDE DCVLLLKNGQWNDVPCSTSHLAVCEFPIVDHHHHHH
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      21 to 248
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This is the mature form without the signal sequence.

Associated products

  • Related Products

    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-Mannan Binding Lectin/MBL antibody [3B6] (ab23457)
    • Anti-Mannan Binding Lectin/MBL antibody [1E2] (ab23458)
    • Anti-Mannan Binding Lectin/MBL antibody [15C5] (ab23460)
    • Anti-Mannan Binding Lectin/MBL antibody [11C9] (ab26277)
    • Anti-6X His tag® antibody [4D11] (ab5000)
    • Anti-6X His tag® antibody (ab9108)

Specifications

Our Abpromise guarantee covers the use of ab151947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as Mannan Binding Lectin

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 94% Phosphate Buffer, 5% Trehalose, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • COLEC 1
    • COLEC1
    • Collectin-1
    • HSMBPC
    • Lectin, mannose-binding, soluble, 2
    • Mannan binding lectin
    • Mannan binding protein
    • Mannan-binding protein
    • Mannose binding lectin
    • Mannose binding lectin (protein C) 2 soluble
    • Mannose binding lectin (protein C) 2, soluble
    • Mannose binding lectin (protein C) 2, soluble (opsonic defect)
    • Mannose binding lectin 2 soluble
    • Mannose binding lectin 2, soluble (opsonic defect)
    • Mannose binding lectin protein C2 soluble opsonic defect
    • Mannose binding protein
    • Mannose binding protein C
    • Mannose binding protein C precursor
    • Mannose binding protein, serum
    • Mannose-binding lectin
    • Mannose-binding protein C
    • MBL
    • MBL 2
    • MBL2
    • MBL2_HUMAN
    • MBL2D
    • MBP
    • MBP 1
    • MBP C
    • MBP-C
    • MBP1
    • MBPB
    • MBPC
    • MBPD
    • MGC116832
    • MGC116833
    • Opsonic defect
    • protein C
    • Soluble mannose binding lectin
    see all
  • Function

    Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.
  • Tissue specificity

    Plasma protein produced mainly in the liver.
  • Involvement in disease

    Note=There is an association between low levels of MBL2 and a defect of opsonization which results in susceptibility to frequent and chronic infections.
  • Sequence similarities

    Contains 1 C-type lectin domain.
    Contains 1 collagen-like domain.
  • Cellular localization

    Secreted.
  • Target information above from: UniProt accession P11226 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Datasheets and documents

    • Datasheet
    • SDS
  • References

    ab151947 has not yet been referenced specifically in any publications.

    Publishing research using ab151947? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab151947.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & advice
    • Buying FAQs
    • RabMAb products
    • Biochemical product FAQs
    Company
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2019 Abcam plc. All rights reserved.