Description

  • Product name

    Recombinant Human Mannose Receptor protein
    See all Mannose Receptor proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAF KLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGN RQEKNIMLY
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      22 to 130
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152538 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • bA541I19.1
    • C type lectin domain family 13 member D
    • C-type lectin domain family 13 member D
    • CD 206
    • CD206
    • CD206 antigen
    • CLEC13D
    • CLEC13DL
    • Macrophage mannose receptor
    • Macrophage mannose receptor 1
    • Macrophage mannose receptor 1 like protein 1
    • Mannose receptor C type 1
    • Mannose receptor C type 1 like 1
    • MMR
    • MRC 1
    • MRC1
    • MRC1_HUMAN
    • MRC1L1
    • OTTHUMP00000045206
    see all
  • Function

    Mediates the endocytosis of glycoproteins by macrophages. Binds both sulfated and non-sulfated polysaccharide chains. Acts as phagocytic receptor for bacteria, fungi and other pathogens.
  • Sequence similarities

    Contains 8 C-type lectin domains.
    Contains 1 fibronectin type-II domain.
    Contains 1 ricin B-type lectin domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152538 stained with Coomassie Blue.

References

ab152538 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152538.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up