Overview

  • Product name

    Recombinant Human Mannosidase II/MAN2A1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      DIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCRFSSKGTGLFCSTTQGK ILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFRIQLR
    • Molecular weight

      37 kDa including tags
    • Amino acids

      1045 to 1144

Specifications

Our Abpromise guarantee covers the use of ab152509 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as Mannosidase II

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 3-1
    • 6-alpha-mannosidase
    • Alpha mannosidase 2
    • alpha Mannosidase II
    • Alpha-mannosidase 2
    • AMAN II
    • Golgi alpha mannosidase II
    • Golgi alpha-mannosidase II
    • Golgi integral membrane protein 7
    • GOLIM7
    • MA2A1_HUMAN
    • MAN II
    • Man2a1
    • MANA 2
    • MANA2
    • MANII
    • Mann II
    • Mannosidase alpha class 2A member 1
    • Mannosidase Two
    • Mannosidase, alpha type II
    • Mannosidase, alpha, II
    • Mannosyl oligosaccharide 1 3 1 6 alpha mannosidase
    • Mannosyl oligosaccharide 1,3 1,6 alpha mannosidase
    • Mannosyl-oligosaccharide 1
    see all
  • Function

    Catalyzes the first committed step in the biosynthesis of complex N-glycans. It controls conversion of high mannose to complex N-glycans; the final hydrolytic step in the N-glycan maturation pathway.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 38 family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152509 stained with Coomassie Blue.

References

ab152509 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152509.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up